A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10661
Swiss-prot Accession number	P48144 (Sequence in FASTA format)
Description	Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)].
Source organism	Clarias macrocephalus (Thai catfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Brain, testis, ovary and stomach. Not pancreas, pituitary, muscle and liver
Post translational modification	N/A
Function	PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator
Protein Length	195 Amino acids
Molecular weight	22443
References	1  PubMed abstract 7758831
Domain Name	Hormone_2
Hormone Name	Pituitary adenylate cyclase-activating polypeptide
Mature Hormone Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK
Position of mature hormone in Pre-Hormone protein	38 Residues from position (130-167)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10663
Swiss-prot Accession number	P41585 (Sequence in FASTA format)
Description	Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)].
Source organism	Oncorhynchus nerka (Sockeye salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator
Protein Length	173 Amino acids
Molecular weight	19704
References	1  PubMed abstract 8344311
Domain Name	Hormone_2
Hormone Name	Pituitary adenylate cyclase-activating polypeptide
Mature Hormone Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYRQRYRNK
Position of mature hormone in Pre-Hormone protein	38 Residues from position (129-166)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated