A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10661 |
Swiss-prot Accession number | P48144 (Sequence in FASTA format) |
Description | Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)]. |
Source organism | Clarias macrocephalus (Thai catfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Brain, testis, ovary and stomach. Not pancreas, pituitary, muscle and liver |
Post translational modification | N/A |
Function | PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator |
Protein Length | 195 Amino acids |
Molecular weight | 22443 |
References | 1 PubMed abstract 7758831 |
Domain Name | Hormone_2 |
Hormone Name | Pituitary adenylate cyclase-activating polypeptide |
Mature Hormone Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK |
Position of mature hormone in Pre-Hormone protein | 38 Residues from position (130-167) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10663 |
Swiss-prot Accession number | P41585 (Sequence in FASTA format) |
Description | Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)]. |
Source organism | Oncorhynchus nerka (Sockeye salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator |
Protein Length | 173 Amino acids |
Molecular weight | 19704 |
References | 1 PubMed abstract 8344311 |
Domain Name | Hormone_2 |
Hormone Name | Pituitary adenylate cyclase-activating polypeptide |
Mature Hormone Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYRQRYRNK |
Position of mature hormone in Pre-Hormone protein | 38 Residues from position (129-166) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |